PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21264.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 251aa    MW: 27934.3 Da    PI: 5.0309
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21264.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++lv+ +  +G  +W+++++  g++R++k+c++rw +yl
  mrna21264.1-v1.0-hybrid 14 KGPWTAEEDKKLVNFILTHGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding49.41e-1572111647
                              HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              + E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++
  mrna21264.1-v1.0-hybrid  72 EAEEQLVIDLHASLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                              67***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-22562IPR009057Homeodomain-like
PROSITE profilePS5129414.483961IPR017930Myb domain
SuperFamilySSF466894.49E-2711108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.67E-101661No hitNo description
PROSITE profilePS5129426.70962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2463117IPR009057Homeodomain-like
SMARTSM007173.1E-1466114IPR001005SANT/Myb domain
CDDcd001676.63E-1171112No hitNo description
PfamPF002496.5E-1472111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLVNFIL THGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL NEAEEQLVID LHASLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPITHVPLQ KQVTTTPQET PCEANIQQSV NIPEHGVSGN ENGSSATENS TSNEAQSLIE  180
ADANVEDDPL VSYILSDTFL EDWSWSFPAV EDGYNDLGLS STSSEDSSSA WFMDCKDFGV  240
EDFELGNCIN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307827.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX63e-98ODO1_PETHY; Protein ODORANT1
TrEMBLQ2LME51e-131Q2LME5_MALDO; MYB19
STRINGPOPTR_0015s14600.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.13e-91myb domain protein 85